PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g39766.1.p
Common NameBRADI_4g39766
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family Nin-like
Protein Properties Length: 372aa    MW: 39833.6 Da    PI: 5.5065
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g39766.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK78.95.5e-25311360352
            RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                        +++++d++ yF+lpi +AA +L+vc+TvLK iCR+ G++RWPhRk+k++
  Bradi4g39766.1.p 311 GKMKFDDIAPYFHLPIVEAAEKLDVCATVLKGICRRVGVQRWPHRKVKKI 360
                       6899********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.12300371IPR003035RWP-RK domain
PfamPF020421.6E-21313360IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MASGDGGEEE DLGMFVDALP LPDDFDDVLH LLDIPVDAAE ADPPVLQPPL TGTAAAAVPV  60
QQQQYNIADC YDYQPASTHG LSGNARPYWP RTMFADGCYS TGAAAVHGEP STSAADCSGC  120
QVLREVVHSN GLEVAKLCIH GGAPGVFNHA MSEVYPVNNN SGGGSAPPSM TQHSCIDFRG  180
RDYDWVRHYL TEYALRLAAG NYAVVSDSLS VFHDVLCTDM NTSIILLDDD GHESAGTTNA  240
CRKQAAATVD SAAATAAAVQ PTIQIRNTEP DQPAAGPSQP PRCATDVRVK QQPLHPVAAR  300
SALALQRERT GKMKFDDIAP YFHLPIVEAA EKLDVCATVL KGICRRVGVQ RWPHRKVKKI  360
RQRDHKTQEI G*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006664445.13e-65PREDICTED: uncharacterized protein LOC102713973
TrEMBLA0A0Q3EWE20.0A0A0Q3EWE2_BRADI; Uncharacterized protein
STRINGOB12G16200.19e-65(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP80552944
Representative plantOGRP5671777
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53040.15e-11RWP-RK domain-containing protein